Rabbit Polyclonal Anti-PRTFDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRTFDC1 antibody: synthetic peptide directed towards the N terminal of human PRTFDC1. Synthetic peptide located within the following region: AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD |
Rabbit Polyclonal Anti-PRTFDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRTFDC1 antibody: synthetic peptide directed towards the middle region of human PRTFDC1. Synthetic peptide located within the following region: MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA |
Rabbit Polyclonal PRTFDC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PRTFDC1 antibody was raised against a 14 amino acid peptide from near the center of human PRTFDC1. |
PRTFDC1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
PRTFDC1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
