Rabbit anti-PSMA4 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA4 |
Rabbit anti-PSMA4 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA4 |
PSMA4 goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_002780.1 and NP_001096138.1 |
Rabbit Polyclonal Anti-PSMA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PSMA4 Antibody: synthetic peptide directed towards the N terminal of human PSMA4. Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN |
Carrier-free (BSA/glycerol-free) PSMA4 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA4 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | IHC, WB |
Reactivities | Human, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA4 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PSMA4 |
PSMA4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PSMA4 |
PSMA4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human PSMA4 (NP_001096137.1). |
Modifications | Unmodified |
PSMA4 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA4 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PSMA4 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
PSMA4 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
PSMA4 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA4 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PSMA4 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
PSMA4 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
PSMA4 mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
PSMA4 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PSMA4 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PSMA4 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PSMA4 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |