Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-RAN (aa 197-210) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAN (aa 197-210) Antibody: Peptide with sequence C-YEHDLEVAQTTALP, from the C Terminus of the protein sequence according to NP_006316.1. |
Rabbit Polyclonal Anti-RAN Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAN antibody: synthetic peptide directed towards the middle region of human RAN. Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA |
Rabbit Polyclonal Anti-RAN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAN Antibody: A synthesized peptide derived from human RAN |
RAN (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RAN |
Goat Polyclonal Antibody against RAN
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AAQGEPQVQFKLV-C, from the N Terminus of the protein sequence according to NP_006316. |
Rabbit anti-RAN polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Anti-RAN Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 200-216 amino acids of Human Ras-related nuclear protein |
Rabbit Polyclonal Anti-RAN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
RAN rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Ran Rabbit polyclonal Antibody
| Applications | FC, IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Ran |
Ran Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RAN