Rabbit Polyclonal Anti-RGS20 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the middle region of human RGS20. Synthetic peptide located within the following region: NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS |
RGS20 (isoform 6 specific) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the N terminal of human RGS20 |
RGS20 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RGS20 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RGS20 |
RGS20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human RGS20 (NP_003693.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
