RGS20 Rabbit Polyclonal Antibody

CAT#: TA334733

Rabbit Polyclonal Anti-RGS20 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RGS20"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the middle region of human RGS20. Synthetic peptide located within the following region: NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name regulator of G-protein signaling 20
Background Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
Synonyms g(z)GAP; gz-GAP; RGSZ1; ZGAP1
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Dog: 92%; Bovine: 86%; Zebrafish: 86%; Mouse: 85%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.