Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-RHCG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERQNSVYQSD, from the internal region of the protein sequence according to NP_057405.1. |
Rabbit Polyclonal Anti-RHCG Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RHCG |
RHCG Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC |
RHCG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-479 of human RHCG (NP_057405.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RHCG