RHCG Rabbit Polyclonal Antibody

CAT#: TA356193

RHCG Antibody - C-terminal region

Product Images

Anti-RHCG antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Anti-RHCG antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Specifications

Product Data

• Applications: IHC, WB
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL
• Specificity: Expected reactivity: Human
  Homology: Human: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 53 kDa
• Gene Name: Rh family C glycoprotein
• Database Link:
  NP_057405
  Entrez Gene 51458 Human
  UniProt ID Q9UBD6
• Synonyms: C15orf6; CDRC2; PDRC2; RHGK; SLC42A3

Reference Data

• Protein Families: Transmembrane