Germany
Japan
United Kingdom
China
RHCG Rabbit Polyclonal Antibody
Product Images
Other products for "RHCG"
Specifications
| Product Data | |
| Applications | IHC |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC |
| Specificity | Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish Homology: Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 86%; Zebrafish: 86% |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Predicted Protein Size | 53 kDa |
| Gene Name | Rh family C glycoprotein |
| Database Link | |
| Synonyms | C15orf6; CDRC2; PDRC2; RHGK; SLC42A3 |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.