Antibodies

Jump to Filters
View as table Download
RNASE9 Rabbit Polyclonal Antibody
TA346522

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNASE9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE9 antibody: synthetic peptide directed towards the N terminal of human RNASE9. Synthetic peptide located within the following region: PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH
RNASE9 Mouse Monoclonal Antibody [Clone ID: OTI4F12]
CF811245

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RNASE9 mouse monoclonal antibody,clone OTI4F12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
RNASE9 Mouse Monoclonal Antibody [Clone ID: OTI4F12]
TA811245

USD 379.00

In Stock

RNASE9 mouse monoclonal antibody,clone OTI4F12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
RNASE9 Mouse Monoclonal Antibody [Clone ID: OTI4F12]
TA811245S

USD 159.00

2 Days

RNASE9 mouse monoclonal antibody,clone OTI4F12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated