Germany
Japan
United Kingdom
China
RNASE9 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of ribonuclease, RNase A family, 9 (non-active) (RNASE9), transcript variant 7
USD 396.00
Other products for "RNASE9"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RNASE9 antibody: synthetic peptide directed towards the N terminal of human RNASE9. Synthetic peptide located within the following region: PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 24 kDa |
| Gene Name | ribonuclease A family member 9 (inactive) |
| Database Link | |
| Background | RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense. |
| Synonyms | h461; HEL128; RAK1 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 86% |
| Reference Data | |
| Protein Families | Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.