Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RAB18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB18. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAB18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAB18 Antibody: synthetic peptide directed towards the C terminal of human RAB18. Synthetic peptide located within the following region: LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG |
Carrier-free (BSA/glycerol-free) RAB18 mouse monoclonal antibody,clone OTI7C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-RAB18 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 128-141 amino acids of Human Ras-related protein Rab-18 |
RAB18 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAB18 |
RAB18 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAB18 |
RAB18 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human RAB18 (NP_067075.1). |
| Modifications | Unmodified |
RAB18 mouse monoclonal antibody,clone OTI7C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
RAB18 mouse monoclonal antibody,clone OTI7C9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAB18 mouse monoclonal antibody,clone OTI7C9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAB18 mouse monoclonal antibody,clone OTI7C9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RAB18