Goat Polyclonal Anti-Rab9 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab9a and Rab9b produced in E. coli. |
Rabbit Polyclonal RAB9A Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-Rab9a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 115 aa to the C-terminus of Rab9a produced in E. coli. |
Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC |
Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV |
RAB9A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAB9A |
RAB9A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human RAB9A (NP_004242.1). |
| Modifications | Unmodified |
Rab9 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Rab9 |
Germany
Japan
United Kingdom
China
