Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to CtIP (retinoblastoma binding protein 8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 452 and 777 of CtIP (Uniprot ID#Q99708) |
Rabbit Polyclonal Anti-RBBP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP8 antibody: synthetic peptide directed towards the C terminal of human RBBP8. Synthetic peptide located within the following region: ETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEE |
Rabbit Polyclonal Anti-RBBP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP8 antibody: synthetic peptide directed towards the middle region of human RBBP8. Synthetic peptide located within the following region: CQQKKEKRNWLPAQDTDSATFHPTHQRIFGKLVFLPLRLVWKEVILRKIL |
Rabbit Polyclonal Anti-RBBP8 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RBBP8 |
RBBP8 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RBBP8 |
RBBP8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RBBP8 (NP_976036.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RBBP8