Antibodies

Jump to Filters
View as table Download
DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody
AP23597PU-N

USD 440.00

2 Weeks

DSCR1L1 (RCAN2) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody
TA306733

USD 430.00

5 Days

Rabbit Polyclonal RCAN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RCAN2 antibody was raised against a 14 amino acid peptide near the center of human RCAN2.
DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody
TA340078

USD 375.00

5 Days

Rabbit Polyclonal Anti-RCAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCAN2 antibody is: synthetic peptide directed towards the middle region of HUMAN RCAN2. Synthetic peptide located within the following region: VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody
TA340079

USD 375.00

5 Days

Rabbit Polyclonal Anti-RCAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCAN2 antibody: synthetic peptide directed towards the middle region of human RCAN2. Synthetic peptide located within the following region: LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG
DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody
TA350900

USD 345.00

In Stock

Rabbit Polyclonal Anti-RCAN2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RCAN2