Rabbit Polyclonal Anti-Rgma Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rgma antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rgma. Synthetic peptide located within the following region: LPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHF |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) RGMA mouse monoclonal antibody,clone OTI4G8
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) RGMA mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RGMA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-450 of human RGMA (NP_064596.2). |
| Modifications | Unmodified |
USD 379.00
In Stock
RGMA mouse monoclonal antibody,clone OTI4G8
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
RGMA mouse monoclonal antibody,clone OTI4G8, Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RGMA mouse monoclonal antibody,clone OTI4G8, HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
RGMA mouse monoclonal antibody,clone OTI4G8
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
RGMA mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
RGMA mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RGMA mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
RGMA mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China