Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RGS17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS17 antibody is: synthetic peptide directed towards the C-terminal region of Human RGS17. Synthetic peptide located within the following region: NRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSE |
Carrier-free (BSA/glycerol-free) RGS17 mouse monoclonal antibody,clone OTI9G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RGS17 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 45-130 of human RGS17 (NP_036551.3). |
| Modifications | Unmodified |
RGS17 mouse monoclonal antibody,clone OTI9G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RGS17 mouse monoclonal antibody,clone OTI9G4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RGS17 mouse monoclonal antibody,clone OTI9G4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RGS17 mouse monoclonal antibody,clone OTI9G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- RGS17