Germany
Japan
United Kingdom
China
Mouse Monoclonal anti-RHO Antibody
| Applications | IF |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal anti-RHO (rhodopsin) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RHO. |
Mouse Monoclonal anti-RHO Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Rhodopsin Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RHO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHO antibody: synthetic peptide directed towards the C terminal of human RHO. Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE |
Rhodopsin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1). |
| Modifications | Unmodified |
Recombinant Anti-Rhodopsin (Clone Rho 1D4)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Cow |
| Conjugation | Unconjugated |
| Modifications | This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Rhodopsin (Clone Rho 1D4)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Cow |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RHO