Rabbit Polyclonal Anti-ZNF313 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF313 antibody: synthetic peptide directed towards the C terminal of human ZNF313. Synthetic peptide located within the following region: VVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQV |
Rabbit Polyclonal Anti-ZNF313 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF313 Antibody: synthetic peptide directed towards the N terminal of human ZNF313. Synthetic peptide located within the following region: AVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIK |
RNF114 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNF114 |
RNF114 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human RNF114 (NP_061153.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
