Antibodies

View as table Download

Rabbit Polyclonal Anti-RNF14 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 Antibody: A synthesized peptide derived from human RNF14

Rabbit Polyclonal Anti-Rnf14 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rnf14 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS

Rabbit Polyclonal Anti-Rnf14 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rnf14 antibody is: synthetic peptide directed towards the middle region of Rat Rnf14. Synthetic peptide located within the following region: QASSNTELALGGAAAAAAASDVDQEDSVDERAVQDVESLSSLIQEILDFN

Rabbit Polyclonal Anti-RNF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the N terminal of human RNF14. Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV

Rabbit Polyclonal Anti-RNF14 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the C terminal of human RNF14. Synthetic peptide located within the following region: CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Carrier-free (BSA/glycerol-free) RNF14 mouse monoclonal antibody,clone OTI3A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNF14 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RNF14 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RNF14

RNF14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14

RNF14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-474 of human RNF14 (NP_004281.1).

RNF14 mouse monoclonal antibody,clone OTI3A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNF14 mouse monoclonal antibody,clone OTI3A4, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RNF14 mouse monoclonal antibody,clone OTI3A4, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RNF14 mouse monoclonal antibody,clone OTI3A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNF14 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNF14 mouse monoclonal antibody,clone OTI1C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated