Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RNF39 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the N terminal of human RNF39. Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD |
Goat Polyclonal Antibody against RNF39
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDPRAPLRIVPAES, from the C Terminus of the protein sequence according to NP_079512.1; NP_739575.1. |
Rabbit Polyclonal Anti-RNF39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the C terminal of human RNF39. Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL |
Carrier-free (BSA/glycerol-free) RNF39 mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
RNF39 mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
RNF39 mouse monoclonal antibody,clone 4D11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RNF39 mouse monoclonal antibody,clone 4D11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RNF39 mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RNF39