Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Rabphilin 3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rabphilin 3A Antibody: A synthesized peptide derived from human Rabphilin 3A |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RPH3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPH3A antibody is: synthetic peptide directed towards the C-terminal region of Human RPH3A. Synthetic peptide located within the following region: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE |
Rabbit Anti-Rabphilin 3A Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit Anti-Rabphilin 3A (ser234) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser234 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RPH3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPH3A antibody: synthetic peptide directed towards the N terminal of human RPH3A. Synthetic peptide located within the following region: GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRK |
Rabbit Polyclonal Anti-RPH3A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rph3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR |
RPH3A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RPH3A |
RPH3A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human RPH3A (NP_055769.2). |
| Modifications | Unmodified |
RPH3A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human RPH3A (NP_055769.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RPH3A