Rabbit Polyclonal Anti-SHARPIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHARPIN antibody: synthetic peptide directed towards the C terminal of human SHARPIN. Synthetic peptide located within the following region: SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP |
Carrier-free (BSA/glycerol-free) SHARPIN mouse monoclonal antibody,clone OTI2B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHARPIN mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SHARPIN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SHARPIN |
SHARPIN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SHARPIN (NP_112236.3). |
| Modifications | Unmodified |
SHARPIN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SHARPIN (NP_112236.3). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
SHARPIN mouse monoclonal antibody,clone OTI2B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SHARPIN mouse monoclonal antibody,clone OTI2B1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SHARPIN mouse monoclonal antibody,clone OTI2B1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SHARPIN mouse monoclonal antibody,clone OTI2B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SHARPIN mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SHARPIN mouse monoclonal antibody,clone OTI1D11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SHARPIN mouse monoclonal antibody,clone OTI1D11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SHARPIN mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
