SHARPIN Rabbit Polyclonal Antibody

CAT#: TA342597

Rabbit Polyclonal Anti-SHARPIN Antibody

Product Images

WB Suggested Anti-SHARPIN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SHARPIN antibody: synthetic peptide directed towards the C terminal of human SHARPIN. Synthetic peptide located within the following region: SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: SHANK associated RH domain interactor
• Database Link:
  NP_112236
  Entrez Gene 81858 Human
  UniProt ID Q9H0F6
• Background: SHARPIN may have a role in normal immune development and control of inflammation.
• Synonyms: SIPL1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome