Rabbit Polyclonal Anti-SLC12A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC12A1 antibody: synthetic peptide directed towards the N terminal of human SLC12A1. Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI |
SLC12A1 (43-57) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Monkey |
| Immunogen | Synthetic peptide from positions 43-57 of human SLC12A1 (NP_000329.2) |
Rabbit Polyclonal Anti-NKCC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | AA109 to 129 of the rat sequence |
Anti-SLC12A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 80-172 amino acids of human solute carrier family 12 (sodium/potassium/chloride transporters), member 1 |
SLC12A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
