Antibodies

Jump to Filters
View as table Download
SLC39A5 Rabbit Polyclonal Antibody
TA320158

USD 430.00

In Stock

Rabbit Polyclonal ZIP5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZIP5 antibody was raised against a 17 amino acid synthetic peptide near the center of human ZIP5.
SLC39A5 Rabbit Polyclonal Antibody
TA334617

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG
SLC39A5 Rabbit Polyclonal Antibody
TA334618

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
SLC39A5 Mouse Monoclonal Antibody [Clone ID: OTI2F2]
CF810144

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
SLC39A5 Rabbit Polyclonal Antibody
TA351697

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC39A5
SLC39A5 Rabbit Polyclonal Antibody
TA367263

USD 380.00

4 Weeks

SLC39A5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC39A5
SLC39A5 Mouse Monoclonal Antibody [Clone ID: OTI2F2]
TA810144

USD 379.00

In Stock

SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
SLC39A5 Mouse Monoclonal Antibody [Clone ID: OTI2F2]
TA810144S

USD 159.00

2 Days

SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated