Antibodies

View as table Download

Rabbit Polyclonal ZIP5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZIP5 antibody was raised against a 17 amino acid synthetic peptide near the center of human ZIP5.

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS

Carrier-free (BSA/glycerol-free) SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SLC39A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC39A5

SLC39A5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC39A5

SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SLC39A5 mouse monoclonal antibody,clone OTI2F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated