Germany
Japan
United Kingdom
China
SLC39A5 Rabbit Polyclonal Antibody
Product Images
Other products for "SLC39A5"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 56 kDa |
| Gene Name | solute carrier family 39 member 5 |
| Database Link | |
| Background | Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003). [supplied by OMIM] |
| Synonyms | LZT-Hs7; MYP24; ZIP5 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.