SLC39A5 Rabbit Polyclonal Antibody

CAT#: TA334618

Rabbit Polyclonal Anti-SLC39A5 Antibody

Product Images

WB Suggested Anti-SLC39A5 Antibody Titration: 1 ug/ml; Positive Control: Placenta

• 

  Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SLC39A5 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 39 member 5
• Database Link:
  NP_775867
  Entrez Gene 283375 Human
  UniProt ID Q6ZMH5
• Background: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]). [supplied by OMIM]
• Synonyms: LZT-Hs7; MYP24; ZIP5
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane