Rabbit Polyclonal Anti-SMARCD3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCD3 antibody: synthetic peptide directed towards the N terminal of human SMARCD3. Synthetic peptide located within the following region: KRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEG |
Rabbit Polyclonal Anti-SMARCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCD3 antibody is: synthetic peptide directed towards the C-terminal region of Human SMARCD3. Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ |
Carrier-free (BSA/glycerol-free) SMARCD3 mouse monoclonal antibody,clone OTI7H8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Smarcd3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
SMARCD3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMARCD3. |
| Modifications | Unmodified |
USD 420.00
4 Weeks
SMARCD3 mouse monoclonal antibody,clone OTI7H8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMARCD3 mouse monoclonal antibody,clone OTI7H8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SMARCD3 mouse monoclonal antibody,clone OTI7H8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SMARCD3 mouse monoclonal antibody,clone OTI7H8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
