SMARCD3 Rabbit Polyclonal Antibody

CAT#: TA339067

Rabbit Polyclonal Anti-SMARCD3 Antibody

Product Images

WB Suggested Anti-SMARCD3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate SMARCD3 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Primary antibody dilution:1:200 Secondary antibody:Donkey anti-rabbit HRP Secondary antibody dilution:1:2000

• 

  Host: Rabbit; Target Name: SMARCD3; Sample Tissue: 293T; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1 ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane/lane; Gel Concentration: 0.12

• 

  Rabbit Anti-SMARCD3 antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMARCD3 antibody: synthetic peptide directed towards the N terminal of human SMARCD3. Synthetic peptide located within the following region: KRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
• Database Link:
  NP_001003801
  Entrez Gene 6604 Human
  UniProt ID Q6STE5
• Background: The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: BAF60C; CRACD3; Rsc6p
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors