SMARCD3 Rabbit Polyclonal Antibody

CAT#: TA330923

Rabbit Polyclonal Anti-SMARCD3 Antibody

Product Images

Host: Rabbit; Target Name: SMARCD3; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SMARCD3 antibody is: synthetic peptide directed towards the C-terminal region of Human SMARCD3. Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
• Database Link:
  NP_003069
  Entrez Gene 6604 Human
  UniProt ID Q6STE5
• Background: SMARCD3 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCD3 is part of the lar.
• Synonyms: BAF60C; CRACD3; Rsc6p
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors