Rabbit polyclonal SP140 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SP140 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 272-301 amino acids from the Central region of human SP140. |
Rabbit Polyclonal Anti-SP140 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SP140 antibody: synthetic peptide directed towards the N terminal of human SP140. Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL |
Goat Anti-SP140 (aa29-41) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EGQNLQEQVCPEP, from the N-Terminus of the protein sequence according to NP_009168.4; NP_001005176.1; NP_001265380.1; NP_001265381.1; NP_001265382.1. |
SP140 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SP140 (NP_001265380). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
