SP140 Rabbit Polyclonal Antibody

CAT#: TA331198

Rabbit Polyclonal Anti-SP140 Antibody

Product Images

WB Suggested Anti-SP140 Antibody Titration: 5.0ug/ml; Positive Control: Raji cell lysateSP140 is supported by BioGPS gene expression data to be expressed in Raji

• 

  Rabbit Anti-SP 140 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SP140 antibody: synthetic peptide directed towards the N terminal of human SP140. Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: SP140 nuclear body protein
• Database Link:
  NP_001005176
  Entrez Gene 11262 Human
  UniProt ID Q13342
• Background: SP140 is the nuclear body protein found specifically in all NP cells. HIV-1 infection induced its partial dispersal from nuclear bodies into cytosolic colocalization with Vif.
• Synonyms: LYSP100; LYSP100-A; LYSP100-B
• Note: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors