Rabbit Polyclonal Anti-Supt4h1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Supt4h1 antibody is: synthetic peptide directed towards the middle region of Rat Supt4h1. Synthetic peptide located within the following region: FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV |
Rabbit Polyclonal Anti-SUPT4H1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT4H1 antibody: synthetic peptide directed towards the middle region of human SUPT4H1. Synthetic peptide located within the following region: NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SUPT4H1 mouse monoclonal antibody, clone OTI6B10 (formerly 6B10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SUPT4H1 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SUPT4H1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
SUPT4H1 mouse monoclonal antibody, clone OTI6B10 (formerly 6B10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
SUPT4H1 mouse monoclonal antibody,clone 6B10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
SUPT4H1 mouse monoclonal antibody,clone 6B10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
SUPT4H1 mouse monoclonal antibody, clone OTI6B10 (formerly 6B10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
SUPT4H1 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
SUPT4H1 mouse monoclonal antibody,clone 5F12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
SUPT4H1 mouse monoclonal antibody,clone 5F12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
SUPT4H1 mouse monoclonal antibody, clone OTI5F12 (formerly 5F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China