Suppressor of Ty 4 homolog 1 (SUPT4H1) Rabbit Polyclonal Antibody

CAT#: TA339068

Rabbit Polyclonal Anti-Supt4h1 Antibody

Product Images

Host: Rabbit; Target Name: Supt4h1; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Supt4h1 antibody is: synthetic peptide directed towards the middle region of Rat Supt4h1. Synthetic peptide located within the following region: FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: SPT4 homolog, DSIF elongation factor subunit
• Database Link:
  NP_003159
  Entrez Gene 287608 Rat
  UniProt ID P63272
• Background: The function of this protein remains unknown.
• Synonyms: SPT4; SPT4H; Supt4a; SUPT4H
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors