Antibodies

View as table Download

Rabbit Polyclonal Anti-SDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDS antibody: synthetic peptide directed towards the N terminal of human SDS. Synthetic peptide located within the following region: AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA

Rabbit Polyclonal Anti-SDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDS antibody: synthetic peptide directed towards the middle region of human SDS. Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI

SDS (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human SDS.

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDS mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human SDS (NP_006834.2).
Modifications Unmodified

SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI4E1 (formerly 4E1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

SDS mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SDS mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated