Antibodies

Jump to Filters
View as table Download
LZTR2 (SEC16B) (C-term) Rabbit Polyclonal Antibody
AP23941PU-N

USD 525.00

2 Weeks

LZTR2 (SEC16B) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SEC16B antibody was raised against synthetic peptide - KLH conjugated
LZTR2 (SEC16B) Rabbit Polyclonal Antibody
TA306930

USD 430.00

5 Days

Rabbit Polyclonal LZTR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LZTR2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LZTR2.
LZTR2 (SEC16B) Rabbit Polyclonal Antibody
TA337949

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEC16B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEC16B antibody is: synthetic peptide directed towards the C-terminal region of Human SEC16B. Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS
LZTR2 (SEC16B) Rabbit Polyclonal Antibody
TA381324

USD 220.00

3 Weeks

SEC16B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-550 of human SEC16B (NP_149118.2).
Modifications Unmodified