Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SEMA7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME |
Rabbit polyclonal anti-SEMA7A antibody (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SEMA7A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-202 amino acids from the N-terminal region of human SEMA7A. |
SEMA7A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 45-280 of human SEMA7A (NP_003603.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SEMA7A