Antibodies

Jump to Filters
View as table Download
Helicase SKI2W (SKIV2L) Rabbit Polyclonal Antibody
TA349136

USD 484.00

5 Days

Rabbit Polyclonal Anti-SLC1A7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7.
Helicase SKI2W (SKIV2L) Rabbit Polyclonal Antibody
TA341578

USD 375.00

5 Days

Rabbit Polyclonal Anti-SKIV2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIV2L antibody: synthetic peptide directed towards the middle region of human SKIV2L. Synthetic peptide located within the following region: SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP