Germany
Japan
United Kingdom
China
LY108 (SLAMF6) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of Human SLAMF6 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLAMF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK |
Rabbit Polyclonal Anti-SLAMF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT |
SLAMF6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLAMF6 |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLAMF6