Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 29 of 29 results

(reset)

SP110 Rabbit Polyclonal Antibody

TA306505

USD 430.00

5 Days

Rabbit Polyclonal IPR1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	IPR1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human IPR1.

1 / 3

2 / 3

3 / 3

Previous Next

SP110 Rabbit Polyclonal Antibody

TA306506

USD 430.00

5 Days

Rabbit Polyclonal IPR1 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	IPR1 antibody was raised against a 16 amino acid peptide near the amino terminus of the human IPR1.

SP110 Rabbit Polyclonal Antibody

TA331675

USD 375.00

5 Days

Rabbit Polyclonal Anti-SP110 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SP110 Antibody: synthetic peptide directed towards the middle region of human SP110. Synthetic peptide located within the following region: LKAYCHPQSSFFTGIPFNIRDYGEPFQEAMWLDLVKERLITEMYTVAWFV

SP110 Rabbit Polyclonal Antibody

TA341442

USD 375.00

5 Days

Rabbit Polyclonal Anti-SP110 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SP110 antibody: synthetic peptide directed towards the C terminal of human SP110. Synthetic peptide located within the following region: LITEMYTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVL

SP110 Rabbit Polyclonal Antibody

TA341443

USD 375.00

5 Days

Rabbit Polyclonal Anti-SP110 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SP110 antibody: synthetic peptide directed towards the middle region of human SP110. Synthetic peptide located within the following region: DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTL

1 / 2

2 / 2

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI4C1]

CF807854

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SP110 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1C3]

CF807900

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SP110 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI2A1]

CF807938

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SP110 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1H5]

CF807939

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SP110 mouse monoclonal antibody,clone OTI1H5

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

SP110 Rabbit Polyclonal Antibody

TA366671

USD 380.00

4 Weeks

SP110 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human SP110

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SP110 Rabbit Polyclonal Antibody

TA371023

USD 380.00

4 Weeks

SP110 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human SP110

SP110 Rabbit Polyclonal Antibody

TA381904

USD 220.00

3 Weeks

SP110 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human SP110 (NP_004501.3).
Modifications	Unmodified

SP110 Rabbit Polyclonal Antibody

TA381905

USD 220.00

3 Weeks

SP110 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human SP110 (NP_004501.3).
Modifications	Unmodified

SP110 Mouse Monoclonal Antibody [Clone ID: OTI4C1]

TA807854

USD 379.00

In Stock

SP110 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

SP110 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C1]

TA807854AM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C1]

TA807854BM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI4C1]

TA807854S

USD 159.00

2 Days

SP110 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1C3]

TA807900

USD 379.00

In Stock

SP110 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SP110 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C3]

TA807900AM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C3]

TA807900BM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1C3]

TA807900S

USD 159.00

2 Days

SP110 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI2A1]

TA807938

USD 379.00

In Stock

SP110 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SP110 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A1]

TA807938AM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]

TA807938BM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI2A1]

TA807938S

USD 159.00

2 Days

SP110 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1H5]

TA807939

USD 379.00

In Stock

SP110 mouse monoclonal antibody,clone OTI1H5

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

SP110 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H5]

TA807939AM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody,clone OTI1H5, Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

TA807939BM

USD 420.00

4 Weeks

SP110 mouse monoclonal antibody,clone OTI1H5, HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

SP110 Mouse Monoclonal Antibody [Clone ID: OTI1H5]

TA807939S

USD 159.00

2 Days

SP110 mouse monoclonal antibody,clone OTI1H5

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 29 of 29 results