Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against TRIM63
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DYKSSLIQDGNPM-C, from the N Terminus of the protein sequence according to NP_115977.2. |
Rabbit Polyclonal Anti-TRIM63 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM63 antibody: synthetic peptide directed towards the middle region of human TRIM63. Synthetic peptide located within the following region: EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ |
Anti-TRIM63 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 2-14 amino acids of human tripartite motif containing 63, E3 ubiquitin protein ligase |
Anti-TRIM63 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 2-14 amino acids of human tripartite motif containing 63, E3 ubiquitin protein ligase |
TRIM63 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRIM63 |
Active filters
Target Symbol
- TRIM63