Antibodies

Jump to Filters
View as table Download
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA345670

USD 475.00

5 Days

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE
TUBA4A
AB0046-200

USD 300.00

In Stock

Goat Polyclonal Anti-TUBA4A Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli.
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA308420

USD 415.00

2 Weeks

Rabbit polyclonal anti-TUBA4A(alpha Tubulin) antibody, Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 243 of alpha Tubulin 4a (Uniprot ID#P68366)
TUBA4A
AB0134-200

USD 300.00

In Stock

Goat Polyclonal Anti-TUBA4A Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 80 aa to the N-terminus of human alpha tubulin produced in E. coli.
TUBA4A
AB0046-500

USD 450.00

In Stock

Goat Polyclonal Anti-TUBA4A Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli.
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA345671

USD 475.00

5 Days

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA326047

USD 345.00

In Stock

Rabbit polyclonal TUBA1/3/4 (Phospho-Tyr272) antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TUBA1/3/4 around the phosphorylation site of tyrosine 272 (A-T-YP-A-P).
Modifications Phospho-specific
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA326208

USD 345.00

In Stock

Rabbit polyclonal TUBA1/3/4 (Ab-272) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TUBA1/3/4 around the phosphorylation site of tyrosine 272 (A-T-YP-A-P).
alpha Tubulin (TUBA4A) (426-450) Rabbit Polyclonal Antibody
AP23576PU-N

USD 440.00

2 Weeks

alpha Tubulin (TUBA4A) (426-450) rabbit polyclonal antibody

Applications IHC
Reactivities Bovine, Chicken, Frog, Guinea Pig, Gerbil, Human, Mouse, Porcine, Rat
Immunogen A synthetic peptide from aa 426-450 of human tubulin alpha
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA324298

USD 345.00

4 Weeks

Anti-TUBA4A Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 127-447 amino acids of Human Tubulin alpha-4A chain
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA362555

USD 360.00

5 Days

TUBA4A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TUBA4A