Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
Rabbit polyclonal anti Substance P
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu- Met-NH2 coupled to carrier protein. |
TAC1 rat monoclonal antibody, clone NC1/34, Supernatant
| Applications | IF, IHC |
| Reactivities | Human |
TAC1 guinea pig polyclonal antibody, Serum
| Applications | FC, IHC |
| Reactivities | Fish, Human, Rabbit, Rat |
| Immunogen | Substance P conjugated to BSA |
TAC1 rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Fish, Human, Porcine, Rat |
| Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |
Rabbit Polyclonal Anti-TAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
Rabbit polyclonal anti Substance P
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Substance P; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to a carrier protein. |
Neurokinin A, rabbit anti Neurokinin A, polyclonal, diluted Antiserum for RIA.
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Neurokinin A; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Neurokinin A; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein. |
Guinea pig polyclonal anti Substance P; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to carrier protein. |
Anti-TAC1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 58-68 amino acids of Human tachykinin, precursor 1 |
TAC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human TAC1 (NP_003173.1). |
| Modifications | Unmodified |
Substance P Rabbit polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Substance P |
Active filters
Target Symbol
- TAC1