Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TBX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX3 Antibody: A synthesized peptide derived from human TBX3 |
Rabbit polyclonal anti-TBX3 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TBX3. |
Rabbit polyclonal anti-TBX3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TBX3. |
Rabbit Polyclonal Anti-TBX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX3 Antibody: synthetic peptide directed towards the middle region of human TBX3. Synthetic peptide located within the following region: VGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGS |
Rabbit Polyclonal Anti-TBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX3 antibody is: synthetic peptide directed towards the C-terminal region of Human TBX3. Synthetic peptide located within the following region: SRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP |
TBX3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 309-338 amino acids from the Central region of human TBX3 |
Carrier-free (BSA/glycerol-free) TBX3 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBX3 mouse monoclonal antibody,clone OTI8H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBX3 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBX3 mouse monoclonal antibody,clone OTI3B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TBX3 |
TBX3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 246-385 of human TBX3 (NP_057653.3). |
| Modifications | Unmodified |
TBX3 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI7C4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TBX3 mouse monoclonal antibody,clone OTI7C4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TBX3 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI8H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI8H5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TBX3 mouse monoclonal antibody,clone OTI8H5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TBX3 mouse monoclonal antibody,clone OTI8H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI8G5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TBX3 mouse monoclonal antibody,clone OTI8G5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TBX3 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI3B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TBX3 mouse monoclonal antibody,clone OTI3B1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TBX3 mouse monoclonal antibody,clone OTI3B1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TBX3 mouse monoclonal antibody,clone OTI3B1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TBX3