Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TCTN2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 435 of rat TCTN2 |
Rabbit Polyclonal TCTN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TCTN2 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human TCTN2. |
Rabbit Polyclonal Anti-TCTN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCTN2 antibody is: synthetic peptide directed towards the N-terminal region of Human TCTN2. Synthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA |
TCTN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-670 of human TCTN2 (NP_079085.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- TCTN2