Rabbit Polyclonal Anti-TDP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tdp1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tdp1. Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY |
Rabbit Polyclonal Anti-TDP1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tdp1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF |
TDP1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (PNDGTAQRTENHG) |
Carrier-free (BSA/glycerol-free) TDP1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TDP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TDP1 (NP_060789.2). |
| Modifications | Unmodified |
TDP1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TDP1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TDP1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TDP1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
