Rabbit polyclonal Anti-TMEM126B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the N terminal of human TMEM126B. Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT |
Rabbit polyclonal Anti-TMEM126B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the middle region of human TMEM126B. Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC |
Germany
Japan
United Kingdom
China