Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Anti-Human CD255 (TWEAK) Purified (25 ug)
| Reactivities | Human |
Anti-Human TWEAK Goat Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | E.coli derived Recombinant Human TWEAK |
Rabbit Polyclonal Anti-TNFSF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA |
Rabbit Polyclonal Anti-TNFSF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF |
TNFSF12 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF12 |
| Modifications | Unmodified |
Recombinant Anti-TWEAK (Clone MTW-1)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-TWEAK (Clone MTW-1)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TNFSF12