Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TOR2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOR2A antibody: synthetic peptide directed towards the N terminal of human TOR2A. Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS |
Rabbit anti TOR2A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti Salusin-a (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg- Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Salusin-a (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg- Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti human Salusin-beta
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg- Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Salusin-b (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg- Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2 coupled to carrier protein. |
Active filters
Target Symbol
- TOR2A