Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM58 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM58 antibody: synthetic peptide directed towards the middle region of human TRIM58. Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH

Rabbit Polyclonal Anti-TRIM60 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM60 antibody: synthetic peptide directed towards the N terminal of human TRIM60. Synthetic peptide located within the following region: LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF

Rabbit Polyclonal Anti-TRIM58 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIM58 antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRIM58.

TRIM58 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58